GIPC2 Antikörper (N-Term)

Produktnummer ABIN629789

Produktdetails anti-GIPC2 Antikörper

Target: GIPC2 (GIPC PDZ Domain Containing Family, Member 2 (GIPC2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GIPC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: GIPC2 antibody was raised against the N terminal of GIPC2

Aufreinigung: Purified

Immunogen: GIPC2 antibody was raised using the N terminal of GIPC2 corresponding to a region with amino acids MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GIPC2 Blocking Peptide, catalog no. 33R-6291, is also available for use as a blocking control in assays to test for specificity of this GIPC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIPC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GIPC2

Target: GIPC2 (GIPC PDZ Domain Containing Family, Member 2 (GIPC2))

Andere Bezeichnung: GIPC2 (GIPC2 Produkte)

Synonyme: SEMCAP-2 antikoerper, SEMCAP2 antikoerper, 2200002N01Rik antikoerper, AU021850 antikoerper, Semcap2 antikoerper, gipc1 antikoerper, rgs19ip1 antikoerper, zgc:56157 antikoerper, zgc:77689 antikoerper, gipc antikoerper, MGC85196 antikoerper, GIPC2 antikoerper, GIPC PDZ domain containing family member 2 antikoerper, GIPC PDZ domain containing family, member 2 antikoerper, GIPC PDZ domain containing family member 2 S homeolog antikoerper, GIPC2 antikoerper, Gipc2 antikoerper, gipc2 antikoerper, gipc2.S antikoerper

Hintergrund: GIPC1/GIPC, GIPC2, and GIPC3 are a family of central PDZ-domain proteins. GIPC2 might play important roles in human gastric cancer through modulation of growth factor signaling or cell adhesion. GIPC1, GIPC2 and GIPC3 might play key roles in carcinogenesis and embryogenesis through modulation of growth factor signaling and cell adhesion.

Molekulargewicht: 35 kDa (MW of target protein)