MKRN1 Antikörper (C-Term)

Produktnummer ABIN629792

Produktdetails anti-MKRN1 Antikörper

Target: MKRN1 (Makorin Ring Finger Protein 1 (MKRN1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MKRN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MKRN1 antibody was raised against the C terminal of MKRN1

Aufreinigung: Purified

Immunogen: MKRN1 antibody was raised using the C terminal of MKRN1 corresponding to a region with amino acids RYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MKRN1 Blocking Peptide, catalog no. 33R-8272, is also available for use as a blocking control in assays to test for specificity of this MKRN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKRN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MKRN1

Target: MKRN1 (Makorin Ring Finger Protein 1 (MKRN1))

Andere Bezeichnung: MKRN1 (MKRN1 Produkte)

Synonyme: MKRN1 antikoerper, MGC84269 antikoerper, mkrn1 antikoerper, Makorin-1 antikoerper, RNF61 antikoerper, RFP antikoerper, makorin ring finger protein 1 antikoerper, E3 ubiquitin-protein ligase makorin-1 antikoerper, makorin ring finger protein 1 S homeolog antikoerper, makorin, ring finger protein, 1 antikoerper, MKRN1 antikoerper, LOC100393879 antikoerper, mkrn1.S antikoerper, Mkrn1 antikoerper

Hintergrund: The Makorin ring finger protein-1 (MKRN1) is a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Chromatin Binding