FBP1 Antikörper (N-Term)

Produktnummer ABIN629795

Produktdetails anti-FBP1 Antikörper

Target: FBP1 (Fructose-1,6-Bisphosphatase 1 (FBP1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: FBP1 antibody was raised against the N terminal of FBP1

Aufreinigung: Purified

Immunogen: FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBP1 Blocking Peptide, catalog no. 33R-10289, is also available for use as a blocking control in assays to test for specificity of this FBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBP1

Target: FBP1 (Fructose-1,6-Bisphosphatase 1 (FBP1))

Andere Bezeichnung: FBP1 (FBP1 Produkte)

Synonyme: FBP antikoerper, Fbp-2 antikoerper, Fbp2 antikoerper, Fbp3 antikoerper, FBP1 antikoerper, fbp2 antikoerper, Fdp antikoerper, CG10611 antikoerper, CG31692 antikoerper, Dmel\\CG31692 antikoerper, FbPase antikoerper, fbp1 antikoerper, cb598 antikoerper, fb57b01 antikoerper, zgc:64127 antikoerper, id:ibd1091 antikoerper, wu:fb17g10 antikoerper, wu:fb57b01 antikoerper, fdp antikoerper, xcc-b100_0105 antikoerper, fbp1l antikoerper, fk92h02 antikoerper, wu:fk92h02 antikoerper, zgc:64096 antikoerper, fbp antikoerper, fbp1.S antikoerper, fructose-bisphosphatase 1 antikoerper, fructose bisphosphatase 1 antikoerper, Fructose-1,6-bisphosphatase antikoerper, fructose-1,6-bisphosphatase antikoerper, fructose-1,6-bisphosphatase 1 antikoerper, fructose-bisphosphatase class I antikoerper, fructose-1,6-bisphosphatase 1b antikoerper, fbp antikoerper, fructose-1,6-bisphosphatase 1a antikoerper, fructose-bisphosphatase 1 L homeolog antikoerper, FBP1 antikoerper, Fbp1 antikoerper, fbp1 antikoerper, LOC100136618 antikoerper, RR_RS07410 antikoerper, fbp antikoerper, fbp1b antikoerper, fbp1a antikoerper, fbp1.L antikoerper

Hintergrund: Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process, Dicarboxylic Acid Transport