TARS Antikörper (N-Term)

Produktnummer ABIN629800

Produktdetails anti-TARS Antikörper

Target: TARS (threonyl-tRNA Synthetase (TARS))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TARS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: TARS antibody was raised against the N terminal of TARS

Aufreinigung: Purified

Immunogen: TARS antibody was raised using the N terminal of TARS corresponding to a region with amino acids PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TARS Blocking Peptide, catalog no. 33R-7067, is also available for use as a blocking control in assays to test for specificity of this TARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TARS

Target: TARS (threonyl-tRNA Synthetase (TARS))

Andere Bezeichnung: TARS (TARS Produkte)

Synonyme: ThrRS antikoerper, wu:fb07c05 antikoerper, wu:fb39c12 antikoerper, zgc:92586 antikoerper, 42/3 antikoerper, CG5353 antikoerper, Dmel\\CG5353 antikoerper, P539 antikoerper, TRS antikoerper, l(2)k04203 antikoerper, threonyl-tRNA synthetase antikoerper, tarsl2 antikoerper, TARS antikoerper, D15Wsu59e antikoerper, threonyl-tRNA synthetase L homeolog antikoerper, threonyl-tRNA synthetase antikoerper, Threonyl-tRNA synthetase antikoerper, threonyl-tRNA synthetase 2, mitochondrial (putative) antikoerper, tars.L antikoerper, tars antikoerper, TARS antikoerper, ThrRS antikoerper, thrS antikoerper, tars2 antikoerper, Tars antikoerper

Hintergrund: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Threonyl-tRNA synthetase belongs to the class-II aminoacyl-tRNA synthetase family.

Molekulargewicht: 78 kDa (MW of target protein)