PPFIBP1 Antikörper
-
- Target Alle PPFIBP1 Antikörper anzeigen
- PPFIBP1 (PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPFIBP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- PPFIBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM
- Top Product
- Discover our top product PPFIBP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPFIBP1 Blocking Peptide, catalog no. 33R-7081, is also available for use as a blocking control in assays to test for specificity of this PPFIBP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPFIBP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPFIBP1 (PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1))
- Andere Bezeichnung
- PPFIBP1 (PPFIBP1 Produkte)
- Synonyme
- liprin-beta-1 antikoerper, L2 antikoerper, SGT2 antikoerper, hSGT2 antikoerper, hSgt2p antikoerper, 4632409B19Rik antikoerper, AW214454 antikoerper, AW261454 antikoerper, PPFIA binding protein 1 antikoerper, PTPRF interacting protein, binding protein 1 (liprin beta 1) antikoerper, PTPRF interacting protein, binding protein 1 (liprin beta 1) S homeolog antikoerper, Ppfibp1 antikoerper, ppfibp1 antikoerper, ppfibp1.S antikoerper, PPFIBP1 antikoerper
- Hintergrund
- PPFIBP1 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis.
- Molekulargewicht
- 19 kDa (MW of target protein)
-