PHYHIP Antikörper (N-Term)

Produktnummer ABIN629804

Produktdetails anti-PHYHIP Antikörper

Target: PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PHYHIP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PHYHIP antibody was raised against the N terminal of PHYHIP

Aufreinigung: Purified

Immunogen: PHYHIP antibody was raised using the N terminal of PHYHIP corresponding to a region with amino acids VSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PHYHIP Blocking Peptide, catalog no. 33R-9807, is also available for use as a blocking control in assays to test for specificity of this PHYHIP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYHIP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PHYHIP

Target: PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))

Andere Bezeichnung: PHYHIP (PHYHIP Produkte)

Synonyme: PHYHIP antikoerper, DYRK1AP3 antikoerper, PAHX-AP antikoerper, PAHXAP1 antikoerper, AW049870 antikoerper, C630010D02Rik antikoerper, Lnap1ip antikoerper, PAHX-AP1 antikoerper, phytanoyl-CoA 2-hydroxylase interacting protein antikoerper, phytanoyl-CoA hydroxylase interacting protein antikoerper, PHYHIP antikoerper, phyhip antikoerper, Phyhip antikoerper

Hintergrund: PHYHIP interacts with PHYH suggests a role in the development of the central system.

Molekulargewicht: 38 kDa (MW of target protein)