PHYHIP Antikörper (N-Term)
-
- Target Alle PHYHIP Antikörper anzeigen
- PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PHYHIP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PHYHIP antibody was raised against the N terminal of PHYHIP
- Aufreinigung
- Purified
- Immunogen
- PHYHIP antibody was raised using the N terminal of PHYHIP corresponding to a region with amino acids VSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQ
- Top Product
- Discover our top product PHYHIP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PHYHIP Blocking Peptide, catalog no. 33R-9807, is also available for use as a blocking control in assays to test for specificity of this PHYHIP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYHIP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))
- Andere Bezeichnung
- PHYHIP (PHYHIP Produkte)
- Hintergrund
- PHYHIP interacts with PHYH suggests a role in the development of the central system.
- Molekulargewicht
- 38 kDa (MW of target protein)
-