HBZ Antikörper (N-Term)
-
- Target Alle HBZ Antikörper anzeigen
- HBZ (Hemoglobin, zeta (HBZ))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HBZ Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- Hemoglobin Zeta antibody was raised against the N terminal of HBZ
- Aufreinigung
- Purified
- Immunogen
- Hemoglobin Zeta antibody was raised using the N terminal of HBZ corresponding to a region with amino acids ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA
- Top Product
- Discover our top product HBZ Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Hemoglobin Zeta Blocking Peptide, catalog no. 33R-2702, is also available for use as a blocking control in assays to test for specificity of this Hemoglobin Zeta antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBZ antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HBZ (Hemoglobin, zeta (HBZ))
- Andere Bezeichnung
- Hemoglobin zeta (HBZ Produkte)
- Hintergrund
- Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes.
- Molekulargewicht
- 16 kDa (MW of target protein)
-