GINS1 Antikörper

Produktnummer ABIN629812

Produktdetails anti-GINS1 Antikörper

Target: GINS1 (GINS Complex Subunit 1 (Psf1 Homolog) (GINS1))

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GINS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: GINS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GINS1 Blocking Peptide, catalog no. 33R-5986, is also available for use as a blocking control in assays to test for specificity of this GINS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GINS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GINS1

Target: GINS1 (GINS Complex Subunit 1 (Psf1 Homolog) (GINS1))

Andere Bezeichnung: GINS1 (GINS1 Produkte)

Synonyme: CG9187 antikoerper, CG9187-PA antikoerper, Dmel\CG9187 antikoerper, psf1 antikoerper, GINS1 antikoerper, zgc:101672 antikoerper, PSF1 antikoerper, 2810418N01Rik antikoerper, Gins4 antikoerper, mKIAA0186 antikoerper, RGD1562246 antikoerper, DNA replication complex GINS protein psf-1 antikoerper, DNA replication complex GINS protein psf1 antikoerper, DNA replication complex GINS protein PSF1 antikoerper, GINS complex subunit 1 antikoerper, CG9187 gene product from transcript CG9187-RA antikoerper, GINS complex subunit 1 (Psf1 homolog) antikoerper, GINS complex subunit 1 (Psf1 homolog) S homeolog antikoerper, DNA replication protein antikoerper, NCU02631 antikoerper, AOR_1_746184 antikoerper, CC1G_12309 antikoerper, CTRG_04863 antikoerper, PAAG_03089 antikoerper, MCYG_01460 antikoerper, PITG_00071 antikoerper, VDBG_04832 antikoerper, MGYG_04613 antikoerper, TERG_08027 antikoerper, gins1 antikoerper, Psf1 antikoerper, GINS1 antikoerper, gins1.S antikoerper, Gins1 antikoerper, PSF1 antikoerper

Hintergrund: The GINS complex plays an essential role in the initiation of DNA replication.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: DNA Replication, Synthesis of DNA