PUS7 Antikörper

Produktnummer ABIN629814

Produktdetails anti-PUS7 Antikörper

Target: PUS7 (Pseudouridylate Synthase 7 Homolog (PUS7))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PUS7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: PUS7 antibody was raised using a synthetic peptide corresponding to a region with amino acids FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PUS7 Blocking Peptide, catalog no. 33R-2838, is also available for use as a blocking control in assays to test for specificity of this PUS7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUS7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PUS7

Target: PUS7 (Pseudouridylate Synthase 7 Homolog (PUS7))

Andere Bezeichnung: PUS7 (PUS7 Produkte)

Synonyme: C330017I15Rik antikoerper, RGD1307054 antikoerper, pseudouridylate synthase 7 (putative) antikoerper, pseudouridylate synthase 7 homolog antikoerper, pseudouridylate synthase 7 (putative) L homeolog antikoerper, pseudouridylate synthase 7 homolog (S. cerevisiae) antikoerper, pseudouridylate synthase 7 antikoerper, PUS7 antikoerper, LOC100449507 antikoerper, pus7 antikoerper, pus7.L antikoerper, Pus7 antikoerper

Hintergrund: PUS7 is involved in RNA binding, pseudouridine synthase activity and isomerase activity.

Molekulargewicht: 75 kDa (MW of target protein)