PRMT1 Antikörper (Middle Region)

Produktnummer ABIN629816

Produktdetails anti-PRMT1 Antikörper

Target: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRMT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: PRMT1 antibody was raised against the middle region of PRMT1

Aufreinigung: Purified

Immunogen: PRMT1 antibody was raised using the middle region of PRMT1 corresponding to a region with amino acids ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRMT1 Blocking Peptide, catalog no. 33R-2736, is also available for use as a blocking control in assays to test for specificity of this PRMT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRMT1

Target: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Andere Bezeichnung: PRMT1 (PRMT1 Produkte)

Hintergrund: PRMT1 is a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4.

Molekulargewicht: 40 kDa (MW of target protein)