PFKL Antikörper (Middle Region)
-
- Target Alle PFKL Antikörper anzeigen
- PFKL (Phosphofructokinase, Liver (PFKL))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PFKL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PFKL antibody was raised against the middle region of PFKL
- Aufreinigung
- Purified
- Immunogen
- PFKL antibody was raised using the middle region of PFKL corresponding to a region with amino acids RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA
- Top Product
- Discover our top product PFKL Primärantikörper
-
anti-Phosphofructokinase, Liver (PFKL) (Center) antibody
PFKL Reaktivität: Human, Maus WB, IHC (p), IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphofructokinase, Liver (PFKL) (AA 229-479) antibodyPFKL Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphofructokinase, Liver (PFKL) (AA 669-699), (C-Term) antibodyPFKL Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB03903 unconjugated
anti-Phosphofructokinase, Liver (PFKL) (AA 700-780) antibodyPFKL Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphofructokinase, Liver (PFKL) (Middle Region) antibodyPFKL Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Schaf, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphofructokinase, Liver (PFKL) (C-Term) antibodyPFKL Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphofructokinase, Liver (PFKL) (C-Term) antibodyPFKL Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Phosphofructokinase, Liver (PFKL) (AA 371-399) antibodyPFKL Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB6851 unconjugated
anti-Phosphofructokinase, Liver (PFKL) (AA 441-540) antibodyPFKL Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2A9 unconjugated
anti-Phosphofructokinase, Liver (PFKL) (C-Term) antibodyPFKL Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PFKL Blocking Peptide, catalog no. 33R-8233, is also available for use as a blocking control in assays to test for specificity of this PFKL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFKL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PFKL (Phosphofructokinase, Liver (PFKL))
- Andere Bezeichnung
- PFKL (PFKL Produkte)
- Synonyme
- PFK-B antikoerper, AA407869 antikoerper, phosphofructokinase, liver type antikoerper, phosphofructokinase, liver, B-type antikoerper, PFKL antikoerper, Pfkl antikoerper
- Hintergrund
- Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.
- Molekulargewicht
- 64 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion, Warburg Effekt
-
