Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M) (N-Term) Antikörper

Produktnummer ABIN629825

Produktdetails

Target: Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: EIF3 M antibody was raised against the N terminal of EIF3

Aufreinigung: Purified

Immunogen: EIF3 M antibody was raised using the N terminal of EIF3 corresponding to a region with amino acids MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF3M Blocking Peptide, catalog no. 33R-6523, is also available for use as a blocking control in assays to test for specificity of this EIF3M antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M)

Andere Bezeichnung: EIF3M (EIF3M Produkte)

Synonyme: ga17 antikoerper, pcid1 antikoerper, hfl-b5 antikoerper, tango7 antikoerper, MGC69424 antikoerper, PCID1 antikoerper, DKFZp459D197 antikoerper, Ga17 antikoerper, Pcid1 antikoerper, Tango7 antikoerper, B5 antikoerper, TANGO7 antikoerper, hfl-B5 antikoerper, GA17 antikoerper, fa16c10 antikoerper, wu:fa16c10 antikoerper, wu:fc41f09 antikoerper, zgc:63996 antikoerper, HFL-B5 antikoerper, RGD1565840 antikoerper, eukaryotic translation initiation factor 3 subunit M antikoerper, eukaryotic translation initiation factor 3, subunit M antikoerper, eukaryotic translation initiation factor 3 subunit M S homeolog antikoerper, eif3m antikoerper, EIF3M antikoerper, Eif3m antikoerper, eif3m.S antikoerper

Substanzklasse: Viral Protein

Hintergrund: EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization