Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M) (N-Term) Antikörper

Produktnummer ABIN629825

Produktdetails

Target: Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: EIF3 M antibody was raised against the N terminal of EIF3

Aufreinigung: Purified

Immunogen: EIF3 M antibody was raised using the N terminal of EIF3 corresponding to a region with amino acids MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF3M Blocking Peptide, catalog no. 33R-6523, is also available for use as a blocking control in assays to test for specificity of this EIF3M antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M)

Andere Bezeichnung: EIF3M (EIF3M Produkte)

Substanzklasse: Viral Protein

Hintergrund: EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization