MAP3K7CL Antikörper (C-Term)

Produktnummer ABIN629829

Produktdetails anti-MAP3K7CL Antikörper

Target: MAP3K7CL (MAP3K7 C-Terminal Like (MAP3K7CL))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAP3K7CL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: C21 ORF7 antibody was raised against the C terminal Of C21 rf7

Aufreinigung: Purified

Immunogen: C21 ORF7 antibody was raised using the C terminal Of C21 rf7 corresponding to a region with amino acids DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C21ORF7 Blocking Peptide, catalog no. 33R-2161, is also available for use as a blocking control in assays to test for specificity of this C21ORF7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAP3K7CL

Target: MAP3K7CL (MAP3K7 C-Terminal Like (MAP3K7CL))

Andere Bezeichnung: C21ORF7 (MAP3K7CL Produkte)

Synonyme: C21orf7 antikoerper, ORF63 antikoerper, Tak1l antikoerper, Map3k7 C-terminal like antikoerper, Map3k7cl antikoerper

Hintergrund: C21orf7 plays a critical role in the TGF-beta signaling transduction pathway.

Molekulargewicht: 27 kDa (MW of target protein)