MAP3K7CL Antikörper (C-Term)
-
- Target Alle MAP3K7CL Antikörper anzeigen
- MAP3K7CL (MAP3K7 C-Terminal Like (MAP3K7CL))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAP3K7CL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- C21 ORF7 antibody was raised against the C terminal Of C21 rf7
- Aufreinigung
- Purified
- Immunogen
- C21 ORF7 antibody was raised using the C terminal Of C21 rf7 corresponding to a region with amino acids DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA
- Top Product
- Discover our top product MAP3K7CL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C21ORF7 Blocking Peptide, catalog no. 33R-2161, is also available for use as a blocking control in assays to test for specificity of this C21ORF7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAP3K7CL (MAP3K7 C-Terminal Like (MAP3K7CL))
- Andere Bezeichnung
- C21ORF7 (MAP3K7CL Produkte)
- Hintergrund
- C21orf7 plays a critical role in the TGF-beta signaling transduction pathway.
- Molekulargewicht
- 27 kDa (MW of target protein)
-