RGS16 Antikörper (C-Term)
-
- Target Alle RGS16 Antikörper anzeigen
- RGS16 (Regulator of G-Protein Signaling 16 (RGS16))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RGS16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RGS16 antibody was raised against the C terminal of RGS16
- Aufreinigung
- Purified
- Immunogen
- RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT
- Top Product
- Discover our top product RGS16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RGS16 Blocking Peptide, catalog no. 33R-1842, is also available for use as a blocking control in assays to test for specificity of this RGS16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RGS16 (Regulator of G-Protein Signaling 16 (RGS16))
- Andere Bezeichnung
- RGS16 (RGS16 Produkte)
- Hintergrund
- RGS16 belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade.
- Molekulargewicht
- 23 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-