RGS16 Antikörper (C-Term)

Produktnummer ABIN629833

Produktdetails anti-RGS16 Antikörper

Target: RGS16 (Regulator of G-Protein Signaling 16 (RGS16))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RGS16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RGS16 antibody was raised against the C terminal of RGS16

Aufreinigung: Purified

Immunogen: RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RGS16 Blocking Peptide, catalog no. 33R-1842, is also available for use as a blocking control in assays to test for specificity of this RGS16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RGS16

Target: RGS16 (Regulator of G-Protein Signaling 16 (RGS16))

Andere Bezeichnung: RGS16 (RGS16 Produkte)

Synonyme: A28-RGS14 antikoerper, A28-RGS14P antikoerper, RGS-R antikoerper, Rgs14 antikoerper, Rgsr antikoerper, XRGSI antikoerper, rgsI-A antikoerper, zgc:110164 antikoerper, rgs16 antikoerper, regulator of G protein signaling 16 antikoerper, regulator of G-protein signaling 16 antikoerper, regulator of G-protein signaling 16 L homeolog antikoerper, RGS16 antikoerper, Rgs16 antikoerper, rgs16.L antikoerper, rgs16 antikoerper

Hintergrund: RGS16 belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling