NNMT Antikörper (N-Term)

Produktnummer ABIN629835

Produktdetails anti-NNMT Antikörper

Target: NNMT (Nicotinamide N-Methyltransferase (NNMT))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NNMT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NNMT antibody was raised against the N terminal of NNMT

Aufreinigung: Purified

Immunogen: NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NNMT Blocking Peptide, catalog no. 33R-5957, is also available for use as a blocking control in assays to test for specificity of this NNMT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNMT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NNMT

Target: NNMT (Nicotinamide N-Methyltransferase (NNMT))

Andere Bezeichnung: NNMT (NNMT Produkte)

Synonyme: MGC64498 antikoerper, Afu1g17750 antikoerper, AO090026000620 antikoerper, nnmt antikoerper, nicotinamide N-methyltransferase S homeolog antikoerper, nicotinamide N-methyltransferase antikoerper, nicotinamide n-methyltransferase antikoerper, Nicotinamide N-methyltransferase antikoerper, nnmt.S antikoerper, CNG02680 antikoerper, AFUA_1G17750 antikoerper, AOR_1_1132194 antikoerper, AOR_1_1124014 antikoerper, CC1G_02598 antikoerper, VDBG_08111 antikoerper, TERG_00572 antikoerper, Tsp_04293 antikoerper, nnmt antikoerper, NNMT antikoerper, Nnmt antikoerper

Hintergrund: N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver.

Molekulargewicht: 29 kDa (MW of target protein)