NNMT Antikörper (N-Term)
-
- Target Alle NNMT Antikörper anzeigen
- NNMT (Nicotinamide N-Methyltransferase (NNMT))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NNMT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NNMT antibody was raised against the N terminal of NNMT
- Aufreinigung
- Purified
- Immunogen
- NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
- Top Product
- Discover our top product NNMT Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NNMT Blocking Peptide, catalog no. 33R-5957, is also available for use as a blocking control in assays to test for specificity of this NNMT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNMT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NNMT (Nicotinamide N-Methyltransferase (NNMT))
- Andere Bezeichnung
- NNMT (NNMT Produkte)
- Hintergrund
- N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver.
- Molekulargewicht
- 29 kDa (MW of target protein)
-