PRMT8 Antikörper (C-Term)

Produktnummer ABIN629836

Produktdetails anti-PRMT8 Antikörper

Target: PRMT8 (Protein Arginine Methyltransferase 8 (PRMT8))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRMT8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRMT8 antibody was raised against the C terminal of PRMT8

Aufreinigung: Purified

Immunogen: PRMT8 antibody was raised using the C terminal of PRMT8 corresponding to a region with amino acids YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRMT8 Blocking Peptide, catalog no. 33R-10164, is also available for use as a blocking control in assays to test for specificity of this PRMT8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRMT8

Target: PRMT8 (Protein Arginine Methyltransferase 8 (PRMT8))

Andere Bezeichnung: PRMT8 (PRMT8 Produkte)

Synonyme: HRMT1L3 antikoerper, HRMT1L4 antikoerper, fj34f03 antikoerper, hrmt1l4 antikoerper, prmt8 antikoerper, wu:fj34f03 antikoerper, zfL3 antikoerper, Hrmt1l3 antikoerper, Hrmt1l4 antikoerper, protein arginine methyltransferase 8 antikoerper, protein arginine methyltransferase 8b antikoerper, protein arginine N-methyltransferase 8 antikoerper, PRMT8 antikoerper, Prmt8 antikoerper, prmt8b antikoerper

Hintergrund: PRMT8 probably methylates the guanidino nitrogens of arginyl residues in some proteins.

Molekulargewicht: 43 kDa (MW of target protein)