ABHD5 Antikörper (N-Term)

Produktnummer ABIN629839

Produktdetails anti-ABHD5 Antikörper

Target: ABHD5 (Abhydrolase Domain Containing 5 (ABHD5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABHD5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ABHD5 antibody was raised against the N terminal of ABHD5

Aufreinigung: Purified

Immunogen: ABHD5 antibody was raised using the N terminal of ABHD5 corresponding to a region with amino acids NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABHD5 Blocking Peptide, catalog no. 33R-6861, is also available for use as a blocking control in assays to test for specificity of this ABHD5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABHD5

Target: ABHD5 (Abhydrolase Domain Containing 5 (ABHD5))

Andere Bezeichnung: ABHD5 (ABHD5 Produkte)

Synonyme: ABHD5 antikoerper, cds antikoerper, cgi58 antikoerper, iecn2 antikoerper, ncie2 antikoerper, abhd5 antikoerper, CDS antikoerper, CGI58 antikoerper, IECN2 antikoerper, NCIE2 antikoerper, 1300003D03Rik antikoerper, 2010002J10Rik antikoerper, CGI-58 antikoerper, IECN5 antikoerper, abhydrolase domain containing 5 antikoerper, abhydrolase domain containing 5a antikoerper, abhydrolase domain containing 5 L homeolog antikoerper, ABHD5 antikoerper, abhd5 antikoerper, abhd5a antikoerper, Abhd5 antikoerper, abhd5.L antikoerper

Hintergrund: ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in ABHD5 gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Lipid Metabolism