TRABD Antikörper (N-Term)

Produktnummer ABIN629842

Produktdetails anti-TRABD Antikörper

Target: TRABD (TraB Domain Containing (TRABD))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRABD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PP2447 antibody was raised against the N terminal Of Pp2447

Aufreinigung: Purified

Immunogen: PP2447 antibody was raised using the N terminal Of Pp2447 corresponding to a region with amino acids MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PP2447 Blocking Peptide, catalog no. 33R-5833, is also available for use as a blocking control in assays to test for specificity of this PP2447 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PP2447 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRABD

Target: TRABD (TraB Domain Containing (TRABD))

Andere Bezeichnung: PP2447 (TRABD Produkte)

Synonyme: TRABD antikoerper, LP6054 antikoerper, PP2447 antikoerper, fb66c10 antikoerper, wu:fb66c10 antikoerper, wu:fi04e11 antikoerper, zgc:66436 antikoerper, 5730502D15Rik antikoerper, AL023039 antikoerper, RGD1310875 antikoerper, TraB domain containing antikoerper, TraB domain containing L homeolog antikoerper, TRABD antikoerper, trabd antikoerper, trabd.L antikoerper, Trabd antikoerper

Hintergrund: The function of PP2447 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 41 kDa (MW of target protein)