PRPS2 Antikörper (Middle Region)

Produktnummer ABIN629843

Produktdetails anti-PRPS2 Antikörper

Target: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus, Hund, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRPS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRPS2 antibody was raised against the middle region of PRPS2

Aufreinigung: Purified

Immunogen: PRPS2 antibody was raised using the middle region of PRPS2 corresponding to a region with amino acids ENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRPS2 Blocking Peptide, catalog no. 33R-2608, is also available for use as a blocking control in assays to test for specificity of this PRPS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRPS2

Target: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Andere Bezeichnung: PRPS2 (PRPS2 Produkte)

Synonyme: prsii antikoerper, PRSII antikoerper, 2610101M19Rik antikoerper, AA589463 antikoerper, AI464149 antikoerper, Prps-2 antikoerper, phosphoribosyl pyrophosphate synthetase 2 L homeolog antikoerper, phosphoribosyl pyrophosphate synthetase 2 antikoerper, prps2.L antikoerper, PRPS2 antikoerper, Prps2 antikoerper

Hintergrund: PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The PRPS2 protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process