METTL13 Antikörper (C-Term)
-
- Target Alle METTL13 Produkte
- METTL13 (Methyltransferase Like 13 (METTL13))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser METTL13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIAA0859 antibody was raised against the C terminal of KIAA0859
- Aufreinigung
- Purified
- Immunogen
- KIAA0859 antibody was raised using the C terminal of KIAA0859 corresponding to a region with amino acids NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIAA0859 Blocking Peptide, catalog no. 33R-6670, is also available for use as a blocking control in assays to test for specificity of this KIAA0859 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0859 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- METTL13 (Methyltransferase Like 13 (METTL13))
- Andere Bezeichnung
- KIAA0859 (METTL13 Produkte)
- Hintergrund
- The function of KIAA0859 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 60 kDa (MW of target protein)
-