METTL13 Antikörper (C-Term)

Produktnummer ABIN629845

Produktdetails anti-METTL13 Antikörper

Target: METTL13 (Methyltransferase Like 13 (METTL13))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser METTL13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIAA0859 antibody was raised against the C terminal of KIAA0859

Aufreinigung: Purified

Immunogen: KIAA0859 antibody was raised using the C terminal of KIAA0859 corresponding to a region with amino acids NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA0859 Blocking Peptide, catalog no. 33R-6670, is also available for use as a blocking control in assays to test for specificity of this KIAA0859 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0859 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu METTL13

Target: METTL13 (Methyltransferase Like 13 (METTL13))

Andere Bezeichnung: KIAA0859 (METTL13 Produkte)

Synonyme: METTL13 antikoerper, KIAA0859 antikoerper, cgi-01 antikoerper, kiaa0859 antikoerper, RGD1311526 antikoerper, 5630401D24Rik antikoerper, feat antikoerper, si:dkey-19f21.2 antikoerper, zgc:152769 antikoerper, methyltransferase like 13 antikoerper, methyltransferase like 13 S homeolog antikoerper, METTL13 antikoerper, mettl13 antikoerper, Mettl13 antikoerper, mettl13.S antikoerper

Hintergrund: The function of KIAA0859 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 60 kDa (MW of target protein)