RBP1 Antikörper (Middle Region)
-
- Target Alle RBP1 Antikörper anzeigen
- RBP1 (Retinol Binding Protein 1, Cellular (RBP1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RBP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RBP1 antibody was raised against the middle region of RBP1
- Aufreinigung
- Purified
- Immunogen
- RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG
- Top Product
- Discover our top product RBP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RBP1 Blocking Peptide, catalog no. 33R-4007, is also available for use as a blocking control in assays to test for specificity of this RBP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBP1 (Retinol Binding Protein 1, Cellular (RBP1))
- Andere Bezeichnung
- RBP1 (RBP1 Produkte)
- Hintergrund
- RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision.
- Molekulargewicht
- 15 kDa (MW of target protein)
-