MTMR1 Antikörper (C-Term)

Produktnummer ABIN629848

Produktdetails anti-MTMR1 Antikörper

Target: MTMR1 (Myotubularin Related Protein 1 (MTMR1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTMR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MTMR1 antibody was raised against the C terminal of MTMR1

Aufreinigung: Purified

Immunogen: MTMR1 antibody was raised using the C terminal of MTMR1 corresponding to a region with amino acids KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTMR1 Blocking Peptide, catalog no. 33R-4322, is also available for use as a blocking control in assays to test for specificity of this MTMR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTMR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTMR1

Target: MTMR1 (Myotubularin Related Protein 1 (MTMR1))

Andere Bezeichnung: MTMR1 (MTMR1 Produkte)

Synonyme: AW049210 antikoerper, MTMR1 antikoerper, mtmr1 antikoerper, zgc:113282 antikoerper, Mtmr1 antikoerper, wu:fi27f12 antikoerper, zgc:113186 antikoerper, myotubularin related protein 1 antikoerper, myotubularin related protein 1a antikoerper, myotubularin-related protein 1 antikoerper, myotubularin related protein 1b antikoerper, MTMR1 antikoerper, Mtmr1 antikoerper, mtmr1a antikoerper, mtmr1 antikoerper, LOC100725517 antikoerper, mtmr1b antikoerper

Hintergrund: MTMR1 is a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases.

Molekulargewicht: 73 kDa (MW of target protein)

Pathways: Inositol Metabolic Process