MTMR1 Antikörper (C-Term)
-
- Target Alle MTMR1 Antikörper anzeigen
- MTMR1 (Myotubularin Related Protein 1 (MTMR1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MTMR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MTMR1 antibody was raised against the C terminal of MTMR1
- Aufreinigung
- Purified
- Immunogen
- MTMR1 antibody was raised using the C terminal of MTMR1 corresponding to a region with amino acids KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY
- Top Product
- Discover our top product MTMR1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MTMR1 Blocking Peptide, catalog no. 33R-4322, is also available for use as a blocking control in assays to test for specificity of this MTMR1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTMR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTMR1 (Myotubularin Related Protein 1 (MTMR1))
- Andere Bezeichnung
- MTMR1 (MTMR1 Produkte)
- Hintergrund
- MTMR1 is a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases.
- Molekulargewicht
- 73 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-