AKR1B10 Antikörper

Produktnummer ABIN629851

Produktdetails anti-AKR1B10 Antikörper

Target: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKR1B10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: AKR1 B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AKR1B10 Blocking Peptide, catalog no. 33R-6669, is also available for use as a blocking control in assays to test for specificity of this AKR1B10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AKR1B10

Target: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Andere Bezeichnung: AKR1B10 (AKR1B10 Produkte)

Synonyme: AKR1B11 antikoerper, AKR1B12 antikoerper, ALDRLn antikoerper, ARL-1 antikoerper, ARL1 antikoerper, HIS antikoerper, HSI antikoerper, 2310005E10Rik antikoerper, Akr1b16 antikoerper, AKR antikoerper, AKR1B10 antikoerper, Akr1b10 antikoerper, aldo-keto reductase family 1 member B10 antikoerper, aldo-keto reductase family 1, member B10 (aldose reductase) antikoerper, aldo-keto reductase family 1 member B10-like 2 antikoerper, AKR1B10 antikoerper, Akr1b10 antikoerper, AKR1B10L2 antikoerper, LOC100585902 antikoerper, LOC100723118 antikoerper, LOC101107697 antikoerper

Hintergrund: AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Molekulargewicht: 35 kDa (MW of target protein)