LRRC2 Antikörper (C-Term)

Produktnummer ABIN629853

Produktdetails anti-LRRC2 Antikörper

Target: LRRC2 (Leucine Rich Repeat Containing 2 (LRRC2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC2 antibody was raised against the C terminal of LRRC2

Aufreinigung: Purified

Immunogen: LRRC2 antibody was raised using the C terminal of LRRC2 corresponding to a region with amino acids NAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC2 Blocking Peptide, catalog no. 33R-6643, is also available for use as a blocking control in assays to test for specificity of this LRRC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC2

Target: LRRC2 (Leucine Rich Repeat Containing 2 (LRRC2))

Andere Bezeichnung: LRRC2 (LRRC2 Produkte)

Synonyme: 2400002D05Rik antikoerper, 4933431K03Rik antikoerper, leucine rich repeat containing 2 antikoerper, LRRC2 antikoerper, Lrrc2 antikoerper

Hintergrund: Leucine-rich repeats (LRRs) are 20-29 amino acid motifs that mediate proteinprotein interactions. The primary function of these motifs is to provide a versatile structural framework for the formation of these protein-protein interactions.

Molekulargewicht: 43 kDa (MW of target protein)