FLJ14213 (N-Term) Antikörper

Produktnummer ABIN629854

Produktdetails

Target: FLJ14213

Bindungsspezifität: N-Term

Reaktivität: Hund, Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FLJ14213 antibody was raised against the N terminal of FLJ14213

Aufreinigung: Purified

Immunogen: FLJ14213 antibody was raised using the N terminal of FLJ14213 corresponding to a region with amino acids SAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ14213 Blocking Peptide, catalog no. 33R-8324, is also available for use as a blocking control in assays to test for specificity of this FLJ14213 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ14213 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: FLJ14213

Hintergrund: FLJ14213 may be part of the TORC2 complex which plays a critical role in AKT1 'Ser-473' phosphorylation, and may modulate the phosphorylation of PKCA and regulate actin cytoskeleton organization

Molekulargewicht: 40 kDa (MW of target protein)