Chromosome 6 Open Reading Frame 134 (C6orf134) (N-Term) Antikörper
-
- Target Alle Chromosome 6 Open Reading Frame 134 (C6orf134) Antikörper anzeigen
- Chromosome 6 Open Reading Frame 134 (C6orf134)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C6 ORF134 antibody was raised against the N terminal Of C6 rf134
- Aufreinigung
- Purified
- Immunogen
- C6 ORF134 antibody was raised using the N terminal Of C6 rf134 corresponding to a region with amino acids MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL
- Top Product
- Discover our top product C6orf134 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C6ORF134 Blocking Peptide, catalog no. 33R-5915, is also available for use as a blocking control in assays to test for specificity of this C6ORF134 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF134 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Chromosome 6 Open Reading Frame 134 (C6orf134)
- Andere Bezeichnung
- C6ORF134 (C6orf134 Produkte)
- Hintergrund
- The function of Chromosome 6 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 36 kDa (MW of target protein)
-