MORF4L1 Antikörper (Middle Region)
-
- Target Alle MORF4L1 Antikörper anzeigen
- MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MORF4L1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- MORF4 L1 antibody was raised against the middle region of MORF4 1
- Aufreinigung
- Purified
- Immunogen
- MORF4 L1 antibody was raised using the middle region of MORF4 1 corresponding to a region with amino acids YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ
- Top Product
- Discover our top product MORF4L1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5-10 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MORF4L1 Blocking Peptide, catalog no. 33R-10055, is also available for use as a blocking control in assays to test for specificity of this MORF4L1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MORF0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))
- Andere Bezeichnung
- MORF4L1 (MORF4L1 Produkte)
- Hintergrund
- MORF4L1 is a novel chromodomain protein that is present in two distinct multiprotein complexes involved in transcriptional activation.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-