SHMT2 Antikörper
-
- Target Alle SHMT2 Antikörper anzeigen
- SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SHMT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- SHMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR
- Top Product
- Discover our top product SHMT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SHMT2 Blocking Peptide, catalog no. 33R-2550, is also available for use as a blocking control in assays to test for specificity of this SHMT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHMT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))
- Andere Bezeichnung
- SHMT2 (SHMT2 Produkte)
- Hintergrund
- SHMT2 plays a role in interconversion of serine and glycine.
- Molekulargewicht
- 56 kDa (MW of target protein)
-