SHMT2 Antikörper
-
- Target Alle SHMT2 Antikörper anzeigen
- SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SHMT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- SHMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR
- Top Product
- Discover our top product SHMT2 Primärantikörper
-
anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) (AA 30-504) antibody
SHMT2 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) antibodySHMT2 Reaktivität: Human, Maus, Ratte WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) (AA 265-504) antibodySHMT2 Reaktivität: Human WB, IHC, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) (AA 1-504) antibodySHMT2 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) (AA 401-503) antibodySHMT2 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 5E7 unconjugated
anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) (C-Term) antibodySHMT2 Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Meerschweinchen, Pferd, Rind (Kuh) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) (AA 72-121) antibodySHMT2 Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Meerschweinchen, Pferd, Rind (Kuh), Zebrafisch (Danio rerio), Fledermaus, Hamster, Affe, Schwein, Xenopus laevis WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) (AA 401-450) antibodySHMT2 Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Meerschweinchen, Pferd, Fledermaus, Hamster, Affe, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) antibodySHMT2 Reaktivität: Human, Maus, Ratte WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) (N-Term) antibodySHMT2 Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Meerschweinchen, Pferd, Rind (Kuh), Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SHMT2 Blocking Peptide, catalog no. 33R-2550, is also available for use as a blocking control in assays to test for specificity of this SHMT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHMT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))
- Andere Bezeichnung
- SHMT2 (SHMT2 Produkte)
- Synonyme
- GLYA antikoerper, SHMT antikoerper, 2700043D08Rik antikoerper, AA408223 antikoerper, AA986903 antikoerper, serine hydroxymethyltransferase 2 antikoerper, serine hydroxymethyltransferase 2 (mitochondrial) antikoerper, serine hydroxymethyltransferase 2 (mitochondrial) L homeolog antikoerper, serine hydroxymethyltransferase, mitochondrial-like antikoerper, SHMT2 antikoerper, Chro.80302 antikoerper, Shmt2 antikoerper, shmt2 antikoerper, shmt2.L antikoerper, SHMT antikoerper
- Hintergrund
- SHMT2 plays a role in interconversion of serine and glycine.
- Molekulargewicht
- 56 kDa (MW of target protein)
-
