STIP1 Antikörper
-
- Target Alle STIP1 Antikörper anzeigen
- STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STIP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS
- Top Product
- Discover our top product STIP1 Primärantikörper
-
anti-Stress-Induced-phosphoprotein 1 (STIP1) (AA 1-543) antibody
STIP1 Reaktivität: Human WB, ELISA, IF, IP, IHC (p) Wirt: Maus Monoclonal 4B6 unconjugated
anti-Stress-Induced-phosphoprotein 1 (STIP1) (AA 445-543) antibodySTIP1 Reaktivität: Human WB, ELISA, IF, IHC (p) Wirt: Maus Monoclonal 1E3 unconjugated
anti-Stress-Induced-phosphoprotein 1 (STIP1) (AA 1-543) antibodySTIP1 Reaktivität: Human WB, ELISA, IF, IHC (p), FACS Wirt: Maus Monoclonal 2E11 unconjugated
anti-Stress-Induced-phosphoprotein 1 (STIP1) (AA 1-169) antibodySTIP1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Stress-Induced-phosphoprotein 1 (STIP1) (AA 1-543) antibodySTIP1 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Stress-Induced-phosphoprotein 1 (STIP1) (AA 1-300) antibodySTIP1 Reaktivität: Human WB, IHC, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Stress-Induced-phosphoprotein 1 (STIP1) (AA 269-297) antibodySTIP1 Reaktivität: Human WB, IHC (p), FACS Wirt: Kaninchen Polyclonal RB17353 unconjugated
anti-Stress-Induced-phosphoprotein 1 (STIP1) antibodySTIP1 Reaktivität: Human WB, IF, IP, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Stress-Induced-phosphoprotein 1 (STIP1) (AA 1-543) antibodySTIP1 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Stress-Induced-phosphoprotein 1 (STIP1) (AA 461-488), (C-Term) antibodySTIP1 Reaktivität: Human, Maus WB, FACS Wirt: Kaninchen Polyclonal RB17354 unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STIP1 Blocking Peptide, catalog no. 33R-10212, is also available for use as a blocking control in assays to test for specificity of this STIP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STIP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))
- Andere Bezeichnung
- STIP1 (STIP1 Produkte)
- Synonyme
- HOP antikoerper, IEF-SSP-3521 antikoerper, P60 antikoerper, STI1 antikoerper, STI1L antikoerper, Hop antikoerper, Sti1 antikoerper, p60 antikoerper, MGC53256 antikoerper, stip1 antikoerper, MGC76181 antikoerper, MGC82554 antikoerper, zgc:92133 antikoerper, stress induced phosphoprotein 1 antikoerper, stress-induced phosphoprotein 1 antikoerper, stress induced phosphoprotein 1 L homeolog antikoerper, Stress-induced-phosphoprotein 1 antikoerper, stress-induced-phosphoprotein 1 antikoerper, stress induced phosphoprotein 1 S homeolog antikoerper, STIP1 antikoerper, Stip1 antikoerper, stip1.L antikoerper, GL50803_27310 antikoerper, PGTG_06468 antikoerper, stip1 antikoerper, stip1.S antikoerper
- Hintergrund
- STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).
- Molekulargewicht
- 63 kDa (MW of target protein)
-
