TNNI2 Antikörper
-
- Target Alle TNNI2 Antikörper anzeigen
- TNNI2 (Fast Skeletal Troponin I (TNNI2))
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TNNI2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- Troponin I Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
- Top Product
- Discover our top product TNNI2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Troponin I Type 2 Blocking Peptide, catalog no. 33R-7190, is also available for use as a blocking control in assays to test for specificity of this Troponin I Type 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNNI2 (Fast Skeletal Troponin I (TNNI2))
- Abstract
- TNNI2 Produkte
- Synonyme
- AMCD2B antikoerper, DA2B antikoerper, FSSV antikoerper, fsTnI antikoerper, TnI-F4 antikoerper, TnI antikoerper, TNI antikoerper, hm:zehn0173 antikoerper, tnni2 antikoerper, tropI-1d antikoerper, zgc:86800 antikoerper, troponin I2, fast skeletal type antikoerper, troponin I type 2 (skeletal, fast) antikoerper, troponin I, fast skeletal muscle-like antikoerper, troponin I, skeletal, fast 2 antikoerper, troponin I type 2a (skeletal, fast), tandem duplicate 4 antikoerper, TNNI2 antikoerper, Tnni2 antikoerper, tnni2a.4 antikoerper
- Hintergrund
- Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
- Molekulargewicht
- 21 kDa (MW of target protein)
-