Niban Antikörper (N-Term)

Produktnummer ABIN629867

Produktdetails anti-Niban Antikörper

Target: Niban (FAM129A) (Family with Sequence Similarity 129, Member A (FAM129A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Niban Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM129 A antibody was raised against the N terminal of FAM129

Aufreinigung: Purified

Immunogen: FAM129 A antibody was raised using the N terminal of FAM129 corresponding to a region with amino acids SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM129A Blocking Peptide, catalog no. 33R-8947, is also available for use as a blocking control in assays to test for specificity of this FAM129A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Niban

Target: Niban (FAM129A) (Family with Sequence Similarity 129, Member A (FAM129A))

Andere Bezeichnung: FAM129A (FAM129A Produkte)

Synonyme: C1orf24 antikoerper, NIBAN antikoerper, AI256368 antikoerper, AU019833 antikoerper, Niban antikoerper, family with sequence similarity 129 member A antikoerper, family with sequence similarity 129, member A antikoerper, FAM129A antikoerper, Fam129a antikoerper

Hintergrund: FAM129A is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis and it is a novel tumor marker.

Molekulargewicht: 103 kDa (MW of target protein)