ATIC Antikörper (Middle Region)

Produktnummer ABIN629868

Produktdetails anti-ATIC Antikörper

Target: ATIC (5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATIC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ATIC antibody was raised against the middle region of ATIC

Aufreinigung: Purified

Immunogen: ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATIC Blocking Peptide, catalog no. 33R-8229, is also available for use as a blocking control in assays to test for specificity of this ATIC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATIC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATIC

Target: ATIC (5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC))

Andere Bezeichnung: ATIC (ATIC Produkte)

Synonyme: AICAR antikoerper, AICARFT antikoerper, IMPCHASE antikoerper, PURH antikoerper, purH antikoerper, 2610509C24Rik antikoerper, AA536954 antikoerper, AW212393 antikoerper, 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase L homeolog antikoerper, bifunctional purine biosynthesis protein PurH antikoerper, bifunctional purine biosynthesis protein purH antikoerper, Bifunctional purine biosynthesis protein purH antikoerper, Bifunctional purine biosynthesis protein PurH antikoerper, 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase antikoerper, atic.L antikoerper, purH antikoerper, ATIC antikoerper, Atic antikoerper

Hintergrund: ATIC is a bifunctional protein requiring dimerization for transformylase activity.

Molekulargewicht: 30 kDa (MW of target protein)