DDC Antikörper

Produktnummer ABIN629869

Produktdetails anti-DDC Antikörper

Target: DDC (Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDC Blocking Peptide, catalog no. 33R-2411, is also available for use as a blocking control in assays to test for specificity of this DDC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDC

Target: DDC (Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC))

Andere Bezeichnung: DDC (DDC Produkte)

Hintergrund: DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Dopaminergic Neurogenesis