PLIN1 Antikörper (N-Term)
(1 reference)-
- Target Alle PLIN1 Antikörper anzeigen
- PLIN1 (Perilipin 1 (PLIN1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLIN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Perilipin antibody was raised against the N terminal of PLIN
- Aufreinigung
- Purified
- Immunogen
- Perilipin antibody was raised using the N terminal of PLIN corresponding to a region with amino acids STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS
- Top Product
- Discover our top product PLIN1 Primärantikörper
-
anti-Perilipin 1 (PLIN1) antibody
PLIN1 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Monoclonal unconjugated
anti-Perilipin 1 (PLIN1) (C-Term) antibodyPLIN1 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Perilipin 1 (PLIN1) (AA 1-522) antibodyPLIN1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Perilipin 1 (PLIN1) (AA 1-210) antibodyPLIN1 Reaktivität: Maus WB, IHC, ICC, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Perilipin 1 (PLIN1) (AA 411-496) antibodyPLIN1 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Perilipin 1 (PLIN1) (AA 101-208) antibodyPLIN1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 4G1 unconjugated
anti-Perilipin 1 (PLIN1) (Internal Region) antibodyVerified PLIN1 Reaktivität: Human WB, ELISA, IHC Wirt: Ziege Polyclonal unconjugated
anti-Perilipin 1 (PLIN1) (AA 81-130) antibodyPLIN1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Schaf, Zebrafisch (Danio rerio), Schwein, Fledermaus, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Perilipin Blocking Peptide, catalog no. 33R-8885, is also available for use as a blocking control in assays to test for specificity of this Perilipin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLIN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
: "Low Neonatal Plasma n-6/n-3 PUFA Ratios Regulate Offspring Adipogenic Potential and Condition Adult Obesity Resistance." in: Diabetes, Vol. 67, Issue 4, pp. 651-661, (2018) (PubMed).
-
: "Low Neonatal Plasma n-6/n-3 PUFA Ratios Regulate Offspring Adipogenic Potential and Condition Adult Obesity Resistance." in: Diabetes, Vol. 67, Issue 4, pp. 651-661, (2018) (PubMed).
-
- Target
- PLIN1 (Perilipin 1 (PLIN1))
- Andere Bezeichnung
- Perilipin (PLIN1 Produkte)
- Hintergrund
- PLIN coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-
