GGTLC1 Antikörper (C-Term)
-
- Target Alle GGTLC1 Antikörper anzeigen
- GGTLC1 (gamma-Glutamyltransferase Light Chain 1 (GGTLC1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Hund, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GGTLC1 Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Spezifität
- GGTLA4 antibody was raised against the C terminal of GGTLA4
- Aufreinigung
- Purified
- Immunogen
- GGTLA4 antibody was raised using the C terminal of GGTLA4 corresponding to a region with amino acids DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY
- Top Product
- Discover our top product GGTLC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GGTLA4 Blocking Peptide, catalog no. 33R-2128, is also available for use as a blocking control in assays to test for specificity of this GGTLA4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGTLA4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GGTLC1 (gamma-Glutamyltransferase Light Chain 1 (GGTLC1))
- Andere Bezeichnung
- GGTLA4 (GGTLC1 Produkte)
- Synonyme
- GGTL6 antikoerper, GGTLA3 antikoerper, GGTLA4 antikoerper, dJ831C21.1 antikoerper, dJ831C21.2 antikoerper, gamma-glutamyltransferase light chain 1 antikoerper, GGTLC1 antikoerper
- Hintergrund
- Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein is similar in sequence to several members of the gamma-glutamyl transpeptidase family.Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione.
- Molekulargewicht
- 25 kDa (MW of target protein)
-