CHD1L Antikörper (Middle Region)
-
- Target Alle CHD1L Antikörper anzeigen
- CHD1L (Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHD1L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CHD1 L antibody was raised against the middle region of CHD1
- Aufreinigung
- Purified
- Immunogen
- CHD1 L antibody was raised using the middle region of CHD1 corresponding to a region with amino acids DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL
- Top Product
- Discover our top product CHD1L Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHD1L Blocking Peptide, catalog no. 33R-1859, is also available for use as a blocking control in assays to test for specificity of this CHD1L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHD0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHD1L (Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L))
- Andere Bezeichnung
- CHD1L (CHD1L Produkte)
- Hintergrund
- CHD1L encodes a protein that interacts with ADP-ribose. ADP-ribosylation of proteins is an important post-translational modification that occurs in a variety of biological processes, including DNA repair, transcription, chromatin biology and long-term memory formation.
- Molekulargewicht
- 45 kDa (MW of target protein)
-