TMEM108 Antikörper (Middle Region)

Produktnummer ABIN629878

Produktdetails anti-TMEM108 Antikörper

Target: TMEM108 (Transmembrane Protein 108 (TMEM108))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM108 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM108 antibody was raised against the middle region of TMEM108

Aufreinigung: Purified

Immunogen: TMEM108 antibody was raised using the middle region of TMEM108 corresponding to a region with amino acids NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM108 Blocking Peptide, catalog no. 33R-6859, is also available for use as a blocking control in assays to test for specificity of this TMEM108 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM108 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM108

Target: TMEM108 (Transmembrane Protein 108 (TMEM108))

Andere Bezeichnung: TMEM108 (TMEM108 Produkte)

Synonyme: TMEM108 antikoerper, CT124 antikoerper, AI462967 antikoerper, B130017P16Rik antikoerper, R74726 antikoerper, RGD1311530 antikoerper, transmembrane protein 108 antikoerper, TMEM108 antikoerper, Tmem108 antikoerper

Hintergrund: TMEM108's function has not been determined yet.

Molekulargewicht: 54 kDa (MW of target protein)