MOV10 Antikörper

Produktnummer ABIN629879

Produktdetails anti-MOV10 Antikörper

Target: MOV10 (Moloney Leukemia Virus 10 (MOV10))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MOV10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MOV10 Blocking Peptide, catalog no. 33R-1300, is also available for use as a blocking control in assays to test for specificity of this MOV10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOV10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MOV10

Target: MOV10 (Moloney Leukemia Virus 10 (MOV10))

Andere Bezeichnung: MOV10 (MOV10 Produkte)

Synonyme: C77703 antikoerper, Mov-10 antikoerper, Capza1 antikoerper, fSAP113 antikoerper, gb110 antikoerper, Mov10 RISC complex RNA helicase antikoerper, Moloney leukemia virus 10 antikoerper, MOV10 antikoerper, Mov10 antikoerper

Hintergrund: MOV10 may be an helicase with an important function in development and/or control of cell proliferation.

Molekulargewicht: 110 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, SARS-CoV-2 Protein Interaktom