ERI1 Antikörper (C-Term)

Produktnummer ABIN629880

Produktdetails anti-ERI1 Antikörper

Target: ERI1 (Exoribonuclease 1 (ERI1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: THEX1 antibody was raised against the C terminal of theX1

Aufreinigung: Purified

Immunogen: THEX1 antibody was raised using the C terminal of theX1 corresponding to a region with amino acids GSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIM

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

THEX1 Blocking Peptide, catalog no. 33R-3597, is also available for use as a blocking control in assays to test for specificity of this THEX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THEX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERI1

Target: ERI1 (Exoribonuclease 1 (ERI1))

Andere Bezeichnung: THEX1 (ERI1 Produkte)

Synonyme: THEX1 antikoerper, thex1 antikoerper, zgc:110635 antikoerper, hexo antikoerper, Eri-1 antikoerper, 3'HEXO antikoerper, HEXO antikoerper, 3'hexo antikoerper, 3110010F15Rik antikoerper, Thex1 antikoerper, eri-1 antikoerper, RGD1308378 antikoerper, exoribonuclease 1 antikoerper, three prime repair exonuclease 1 antikoerper, exoribonuclease 1 L homeolog antikoerper, 3'-5' exonuclease eri-1 antikoerper, ERI1 antikoerper, CpipJ_CPIJ003945 antikoerper, eri1 antikoerper, eri1.L antikoerper, Eri1 antikoerper, eri-1 antikoerper

Hintergrund: THEX1 contains 1 SAP domain and 1 exonuclease domain. It is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi).

Molekulargewicht: 38 kDa (MW of target protein)