ERI1 Antikörper (C-Term)
-
- Target Alle ERI1 Antikörper anzeigen
- ERI1 (Exoribonuclease 1 (ERI1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ERI1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- THEX1 antibody was raised against the C terminal of theX1
- Aufreinigung
- Purified
- Immunogen
- THEX1 antibody was raised using the C terminal of theX1 corresponding to a region with amino acids GSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIM
- Top Product
- Discover our top product ERI1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
THEX1 Blocking Peptide, catalog no. 33R-3597, is also available for use as a blocking control in assays to test for specificity of this THEX1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THEX1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERI1 (Exoribonuclease 1 (ERI1))
- Andere Bezeichnung
- THEX1 (ERI1 Produkte)
- Hintergrund
- THEX1 contains 1 SAP domain and 1 exonuclease domain. It is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi).
- Molekulargewicht
- 38 kDa (MW of target protein)
-