DDX49 Antikörper
-
- Target Alle DDX49 Antikörper anzeigen
- DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))
-
Reaktivität
- Human, Hund, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DDX49 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR
- Top Product
- Discover our top product DDX49 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DDX49 Blocking Peptide, catalog no. 33R-2530, is also available for use as a blocking control in assays to test for specificity of this DDX49 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX49 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))
- Andere Bezeichnung
- DDX49 (DDX49 Produkte)
- Hintergrund
- The function of Anti-DDX49 has not yet been determined.
- Molekulargewicht
- 53 kDa (MW of target protein)
-