DDX49 Antikörper

Produktnummer ABIN629881

Produktdetails anti-DDX49 Antikörper

Target: DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))

Reaktivität: Human, Hund, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX49 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX49 Blocking Peptide, catalog no. 33R-2530, is also available for use as a blocking control in assays to test for specificity of this DDX49 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX49 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX49

Target: DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))

Andere Bezeichnung: DDX49 (DDX49 Produkte)

Synonyme: MGC76291 antikoerper, r27090_2 antikoerper, DDX49 antikoerper, wu:fb82g04 antikoerper, wu:fd12e05 antikoerper, ddx49-a antikoerper, R27090_2 antikoerper, DEAD-box helicase 49 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 antikoerper, DEAD-box helicase 49 S homeolog antikoerper, ddx49 antikoerper, DDX49 antikoerper, ddx49.S antikoerper, Ddx49 antikoerper

Hintergrund: The function of Anti-DDX49 has not yet been determined.

Molekulargewicht: 53 kDa (MW of target protein)