CSDC2 Antikörper (N-Term)

Produktnummer ABIN629884

Produktdetails anti-CSDC2 Antikörper

Target: CSDC2 (Cold Shock Domain Containing C2, RNA Binding (CSDC2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSDC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CSDC2 antibody was raised against the N terminal of CSDC2

Aufreinigung: Purified

Immunogen: CSDC2 antibody was raised using the N terminal of CSDC2 corresponding to a region with amino acids MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CSDC2 Blocking Peptide, catalog no. 33R-6562, is also available for use as a blocking control in assays to test for specificity of this CSDC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSDC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CSDC2

Target: CSDC2 (Cold Shock Domain Containing C2, RNA Binding (CSDC2))

Andere Bezeichnung: CSDC2 (CSDC2 Produkte)

Hintergrund: CSDC2 is an RNA-binding factor which binds specifically to the very 3'UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain.

Molekulargewicht: 17 kDa (MW of target protein)