CSDC2 Antikörper (N-Term)

Produktnummer ABIN629884

Produktdetails anti-CSDC2 Antikörper

Target: CSDC2 (Cold Shock Domain Containing C2, RNA Binding (CSDC2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSDC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CSDC2 antibody was raised against the N terminal of CSDC2

Aufreinigung: Purified

Immunogen: CSDC2 antibody was raised using the N terminal of CSDC2 corresponding to a region with amino acids MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CSDC2 Blocking Peptide, catalog no. 33R-6562, is also available for use as a blocking control in assays to test for specificity of this CSDC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSDC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CSDC2

Target: CSDC2 (Cold Shock Domain Containing C2, RNA Binding (CSDC2))

Andere Bezeichnung: CSDC2 (CSDC2 Produkte)

Synonyme: pippin antikoerper, csdc2 antikoerper, zgc:91826 antikoerper, PIPPIN antikoerper, dJ347H13.2 antikoerper, AI415250 antikoerper, AI481750 antikoerper, Pippin antikoerper, cold shock domain containing C2, RNA binding antikoerper, cold shock domain containing C2 antikoerper, cold shock domain containing C2, RNA binding a antikoerper, cold shock domain containing C2 L homeolog antikoerper, CSDC2 antikoerper, csdc2 antikoerper, csdc2a antikoerper, csdc2.L antikoerper, Csdc2 antikoerper

Hintergrund: CSDC2 is an RNA-binding factor which binds specifically to the very 3'UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain.

Molekulargewicht: 17 kDa (MW of target protein)