HNRNPA1 Antikörper (C-Term)
-
- Target Alle HNRNPA1 Antikörper anzeigen
- HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HNRNPA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- HNRPA1 antibody was raised against the C terminal of HNRPA1
- Aufreinigung
- Purified
- Immunogen
- HNRPA1 antibody was raised using the C terminal of HNRPA1 corresponding to a region with amino acids NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSG
- Top Product
- Discover our top product HNRNPA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HNRPA1 Blocking Peptide, catalog no. 33R-6846, is also available for use as a blocking control in assays to test for specificity of this HNRPA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))
- Andere Bezeichnung
- HNRPA1 (HNRNPA1 Produkte)
- Synonyme
- HNRPA1 antikoerper, HNRPA1L3 antikoerper, hnRNP A1 antikoerper, hnRNP-A1 antikoerper, hnrpa1 antikoerper, TPT1P antikoerper, HNRNPA1 antikoerper, D15Ertd119e antikoerper, Hdp antikoerper, Hnrpa1 antikoerper, hnrnp-A1 antikoerper, ROA1 antikoerper, zgc:66127 antikoerper, heterogeneous nuclear ribonucleoprotein A1 antikoerper, heterogeneous nuclear ribonucleoprotein A1b antikoerper, Heterogeneous nuclear ribonucleoprotein A1 antikoerper, heterogeneous nuclear ribonucleoprotein A1 S homeolog antikoerper, ribonucleoprotein A1a antikoerper, heterogeneous nuclear ribonucleoprotein A1-like antikoerper, heterogeneous nuclear ribonucleoprotein A1a antikoerper, HNRNPA1 antikoerper, hnrnpa1b antikoerper, LOC100101226 antikoerper, roa1 antikoerper, Hnrnpa1 antikoerper, hnrnpa1.S antikoerper, hnrnpa1 antikoerper, LOC100359118 antikoerper, hnrnpa1a antikoerper
- Hintergrund
- HNRPA1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). HNRPA1 has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. HNRPA1 is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition.
- Molekulargewicht
- 35 kDa (MW of target protein)
-