PPP1R8 Antikörper

Produktnummer ABIN629887

Produktdetails anti-PPP1R8 Antikörper

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP1R8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: PPP1 R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP1R8 Blocking Peptide, catalog no. 33R-7235, is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP1R8

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Andere Bezeichnung: PPP1R8 (PPP1R8 Produkte)

Synonyme: ARD-1 antikoerper, ARD1 antikoerper, NIPP-1 antikoerper, NIPP1 antikoerper, PRO2047 antikoerper, 6330548N22Rik antikoerper, AU044684 antikoerper, PPP1R8 antikoerper, ard-1 antikoerper, ard1 antikoerper, nipp-1 antikoerper, nipp1 antikoerper, ppp1r8 antikoerper, si:ch211-206a7.1 antikoerper, protein phosphatase 1 regulatory subunit 8 antikoerper, protein phosphatase 1, regulatory subunit 8 antikoerper, protein phosphatase 1, regulatory (inhibitor) subunit 8 antikoerper, protein phosphatase 1, regulatory subunit 8b antikoerper, protein phosphatase 1 regulatory subunit 8 L homeolog antikoerper, protein phosphatase 1, regulatory subunit 8a antikoerper, protein phosphatase 1 regulatory subunit 8 S homeolog antikoerper, PPP1R8 antikoerper, Ppp1r8 antikoerper, ppp1r8b antikoerper, ppp1r8.L antikoerper, ppp1r8a antikoerper, ppp1r8.S antikoerper

Hintergrund: This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

Molekulargewicht: 14 kDa (MW of target protein)