PPP1R8 Antikörper
-
- Target Alle PPP1R8 Antikörper anzeigen
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPP1R8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- PPP1 R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK
- Top Product
- Discover our top product PPP1R8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPP1R8 Blocking Peptide, catalog no. 33R-7235, is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
- Andere Bezeichnung
- PPP1R8 (PPP1R8 Produkte)
- Hintergrund
- This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.
- Molekulargewicht
- 14 kDa (MW of target protein)
-