NONO Antikörper (C-Term)

Produktnummer ABIN629889

Produktdetails anti-NONO Antikörper

Target: NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

Bindungsspezifität: C-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NONO Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: NONO antibody was raised against the C terminal of NONO

Aufreinigung: Purified

Immunogen: NONO antibody was raised using the C terminal of NONO corresponding to a region with amino acids DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NONO Blocking Peptide, catalog no. 33R-1969, is also available for use as a blocking control in assays to test for specificity of this NONO antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NONO antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NONO

Target: NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

Andere Bezeichnung: NONO (NONO Produkte)

Synonyme: NMT55 antikoerper, NRB54 antikoerper, P54 antikoerper, P54NRB antikoerper, nmt55 antikoerper, nrb54 antikoerper, p54nrb antikoerper, xp54nrb antikoerper, AA407051 antikoerper, AV149256 antikoerper, nonA antikoerper, non-POU domain containing octamer binding antikoerper, non-POU domain containing, octamer-binding antikoerper, non-POU domain containing, octamer binding L homeolog antikoerper, non-POU-domain-containing, octamer binding protein antikoerper, NONO antikoerper, Nono antikoerper, nono.L antikoerper

Hintergrund: NONO is DNA- and RNA binding protein, involved in several nuclear processes. It binds the conventional octamer sequence in double stranded DNA. It also binds single-stranded DNA and RNA at a site independent of the duplex site. It is involved in pre-mRNA splicing and interacts with U5 snRNA. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs, be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1 and be involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription.

Molekulargewicht: 52 kDa (MW of target protein)