RBMS3 Antikörper (C-Term)

Produktnummer ABIN629891

Produktdetails anti-RBMS3 Antikörper

Target: RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))

Bindungsspezifität: C-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBMS3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBMS3 antibody was raised against the C terminal of RBMS3

Aufreinigung: Purified

Immunogen: RBMS3 antibody was raised using the C terminal of RBMS3 corresponding to a region with amino acids TAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKP

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBMS3 Blocking Peptide, catalog no. 33R-8991, is also available for use as a blocking control in assays to test for specificity of this RBMS3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBMS3

Target: RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))

Andere Bezeichnung: RBMS3 (RBMS3 Produkte)

Synonyme: RBMS3 antikoerper, zgc:153698 antikoerper, 6720477E09Rik antikoerper, 8430436O14Rik antikoerper, RNA binding motif single stranded interacting protein 3 antikoerper, RNA binding motif, single stranded interacting protein antikoerper, RNA binding motif, single stranded interacting protein 3 antikoerper, RBMS3 antikoerper, rbms3 antikoerper, Rbms3 antikoerper

Hintergrund: RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.

Molekulargewicht: 46 kDa (MW of target protein)