HNRNPD/AUF1 Antikörper
-
- Target Alle HNRNPD/AUF1 (HNRNPD) Antikörper anzeigen
- HNRNPD/AUF1 (HNRNPD) (Heterogeneous Nuclear Ribonucleoprotein D (HNRNPD))
-
Reaktivität
- Human, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HNRNPD/AUF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- HNRPD antibody was raised using a synthetic peptide corresponding to a region with amino acids YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP
- Top Product
- Discover our top product HNRNPD Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HNRPD Blocking Peptide, catalog no. 33R-10116, is also available for use as a blocking control in assays to test for specificity of this HNRPD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPD/AUF1 (HNRNPD) (Heterogeneous Nuclear Ribonucleoprotein D (HNRNPD))
- Andere Bezeichnung
- HNRPD (HNRNPD Produkte)
- Synonyme
- AUF1 antikoerper, AUF1A antikoerper, HNRPD antikoerper, P37 antikoerper, hnRNPD0 antikoerper, Auf1 antikoerper, Hnrnpd antikoerper, HNRNPD antikoerper, p37 antikoerper, auf1a antikoerper, hnrpd antikoerper, hnrnpd0 antikoerper, C230004L04 antikoerper, Hnrpd antikoerper, wu:fa28b06 antikoerper, zgc:162951 antikoerper, heterogeneous nuclear ribonucleoprotein D antikoerper, heterogeneous nuclear ribonucleoprotein D L homeolog antikoerper, HNRNPD antikoerper, Hnrnpd antikoerper, hnrnpd antikoerper, hnrnpd.L antikoerper
- Hintergrund
- HNRPD belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.
- Molekulargewicht
- 39 kDa (MW of target protein)
-