SURF6 Antikörper (Middle Region)
-
- Target Alle SURF6 Antikörper anzeigen
- SURF6 (Surfeit 6 (SURF6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SURF6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SURF6 antibody was raised against the middle region of SURF6
- Aufreinigung
- Purified
- Immunogen
- SURF6 antibody was raised using the middle region of SURF6 corresponding to a region with amino acids EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL
- Top Product
- Discover our top product SURF6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SURF6 Blocking Peptide, catalog no. 33R-2644, is also available for use as a blocking control in assays to test for specificity of this SURF6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SURF6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SURF6 (Surfeit 6 (SURF6))
- Andere Bezeichnung
- SURF6 (SURF6 Produkte)
- Synonyme
- RRP14 antikoerper, CG4510 antikoerper, Dmel\\CG4510 antikoerper, SURF6 antikoerper, surf6 antikoerper, MGC79828 antikoerper, D2Wsu129e antikoerper, Surf-6 antikoerper, surf6l antikoerper, zgc:64008 antikoerper, surfeit 6 antikoerper, Surfeit 6 antikoerper, surfeit locus protein 6 pseudogene antikoerper, surfeit locus protein 6-like antikoerper, surfeit gene 6 antikoerper, surfeit 6 L homeolog antikoerper, SURF6 antikoerper, Surf6 antikoerper, LOC485740 antikoerper, surf6 antikoerper, LOC100222495 antikoerper, surf6.L antikoerper
- Hintergrund
- This gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. The gene demonstrates features of a housekeeping gene, being ubiquitously expressed, and the encoded protein has been localized to the nucleolus. The protein includes motifs found in both the mouse and fish orthologs, which suggests a putative function as a nucleolar-matrix protein with nucleic acid-binding properties, based on characteristics determined in mouse.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-