THO Complex 4 Antikörper (N-Term)

Produktnummer ABIN629900

Produktdetails anti-THO Complex 4 Antikörper

Target: THO Complex 4 (THOC4)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser THO Complex 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: THOC4 antibody was raised against the N terminal of THOC4

Aufreinigung: Purified

Immunogen: THOC4 antibody was raised using the N terminal of THOC4 corresponding to a region with amino acids GGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

THOC4 Blocking Peptide, catalog no. 33R-3282, is also available for use as a blocking control in assays to test for specificity of this THOC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu THO Complex 4

Target: THO Complex 4 (THOC4)

Andere Bezeichnung: THOC4 (THOC4 Produkte)

Hintergrund: THOC4 is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.

Molekulargewicht: 28 kDa (MW of target protein)