EXOSC4 Antikörper (N-Term)
-
- Target Alle EXOSC4 Antikörper anzeigen
- EXOSC4 (Exosome Component 4 (EXOSC4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EXOSC4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- EXOSC4 antibody was raised against the N terminal of EXOSC4
- Aufreinigung
- Purified
- Immunogen
- EXOSC4 antibody was raised using the N terminal of EXOSC4 corresponding to a region with amino acids SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE
- Top Product
- Discover our top product EXOSC4 Primärantikörper
-
anti-Exosome Component 4 (EXOSC4) (AA 1-100) antibody
EXOSC4 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 4F10 unconjugated
anti-Exosome Component 4 (EXOSC4) (N-Term) antibodyEXOSC4 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Pferd, Meerschweinchen, Kaninchen, Xenopus laevis, Affe, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 4 (EXOSC4) antibodyEXOSC4 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 4 (EXOSC4) (N-Term) antibodyEXOSC4 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Pferd, Meerschweinchen, Kaninchen, Saccharomyces cerevisiae, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 4 (EXOSC4) (AA 69-96) antibodyEXOSC4 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB37090 unconjugated
anti-Exosome Component 4 (EXOSC4) (AA 1-245) antibodyEXOSC4 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Exosome Component 4 (EXOSC4) antibodyEXOSC4 Reaktivität: Human, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 4 (EXOSC4) (AA 1-245) antibodyEXOSC4 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EXOSC4 Blocking Peptide, catalog no. 33R-8366, is also available for use as a blocking control in assays to test for specificity of this EXOSC4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EXOSC4 (Exosome Component 4 (EXOSC4))
- Andere Bezeichnung
- EXOSC4 (EXOSC4 Produkte)
- Synonyme
- EXOSC4 antikoerper, zgc:73175 antikoerper, RRP41 antikoerper, RRP41A antikoerper, Rrp41p antikoerper, SKI6 antikoerper, Ski6p antikoerper, hRrp41p antikoerper, p12A antikoerper, 1110039I09Rik antikoerper, 1500001N04Rik antikoerper, Rrp41 antikoerper, exosome component 4 antikoerper, exosome component 4 S homeolog antikoerper, exosc4 antikoerper, EXOSC4 antikoerper, CC1G_03561 antikoerper, exosc4.S antikoerper, Exosc4 antikoerper
- Hintergrund
- EXOSC4 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity.
- Molekulargewicht
- 27 kDa (MW of target protein)
-
