SF3B1 Antikörper (N-Term)

Produktnummer ABIN629906

Produktdetails anti-SF3B1 Antikörper

Target: SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SF3B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SF3 B1 antibody was raised against the N terminal of SF3 1

Aufreinigung: Purified

Immunogen: SF3 B1 antibody was raised using the N terminal of SF3 1 corresponding to a region with amino acids MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SF3B1 Blocking Peptide, catalog no. 33R-5678, is also available for use as a blocking control in assays to test for specificity of this SF3B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SF3B1

Target: SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))

Andere Bezeichnung: SF3B1 (SF3B1 Produkte)

Synonyme: Cus1 antikoerper, SAP145 antikoerper, SF3B145 antikoerper, SF3b1 antikoerper, SF3b150 antikoerper, Hsh155 antikoerper, MDS antikoerper, PRP10 antikoerper, PRPF10 antikoerper, SAP155 antikoerper, SF3b155 antikoerper, 155kDa antikoerper, 2810001M05Rik antikoerper, AA409119 antikoerper, Prp10 antikoerper, TA-8 antikoerper, Targ4 antikoerper, hsh155 antikoerper, prp10 antikoerper, prpf10 antikoerper, sap155 antikoerper, SF3B1 antikoerper, Sap155 antikoerper, wu:fb99f09 antikoerper, splicing factor 3b subunit 2 antikoerper, splicing factor 3b subunit 1 antikoerper, splicing factor 3b, subunit 1 antikoerper, splicing factor 3b subunit 1 S homeolog antikoerper, SF3B2 antikoerper, SF3B1 antikoerper, Sf3b1 antikoerper, sf3b1.S antikoerper, sf3b1 antikoerper

Hintergrund: SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.

Molekulargewicht: 143 kDa (MW of target protein)

Pathways: Chromatin Binding