SF3B1 Antikörper (N-Term)
-
- Target Alle SF3B1 Antikörper anzeigen
- SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SF3B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SF3 B1 antibody was raised against the N terminal of SF3 1
- Aufreinigung
- Purified
- Immunogen
- SF3 B1 antibody was raised using the N terminal of SF3 1 corresponding to a region with amino acids MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR
- Top Product
- Discover our top product SF3B1 Primärantikörper
-
anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) antibody
SF3B1 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Monoclonal unconjugated
anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) antibodySF3B1 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Monoclonal 6C7 unconjugated Recombinant Antibody
anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) (AA 374-402), (N-Term) antibodySF3B1 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB33758 unconjugated
anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) (AA 1-144) antibodySF3B1 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) (N-Term) antibodySF3B1 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Ziege, Kaninchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) (AA 186-378) antibodySF3B1 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) (Middle Region) antibodySF3B1 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Ziege, Kaninchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) (AA 98-198) antibodySF3B1 Reaktivität: Human, Maus WB, IF, IP Wirt: Maus Monoclonal 16 unconjugated
anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) (Middle Region) antibodySF3B1 Reaktivität: Human, Maus, Ratte, Hund WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) (N-Term) antibodySF3B1 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SF3B1 Blocking Peptide, catalog no. 33R-5678, is also available for use as a blocking control in assays to test for specificity of this SF3B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))
- Andere Bezeichnung
- SF3B1 (SF3B1 Produkte)
- Hintergrund
- SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.
- Molekulargewicht
- 143 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-
